PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0037s0082.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 519aa    MW: 56680.6 Da    PI: 7.0272
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0037s0082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.95.8e-30212269260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           DgynWrKYGqK+vkg efprsYY+Ct+++C+vkk +er++ d++++e++Y+g+H h+k
  Kalax.0037s0082.1.p 212 TDGYNWRKYGQKHVKGCEFPRSYYKCTHPNCEVKKLLERAH-DGRITEVIYKGTHSHPK 269
                          6***************************************9.***************85 PP

2WRKY100.97.6e-32376433259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           Dgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+ +d k v++tYeg+Hnh+
  Kalax.0037s0082.1.p 376 VDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERACHDIKSVITTYEGKHNHD 433
                          5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-26202270IPR003657WRKY domain
PROSITE profilePS5081122.492206270IPR003657WRKY domain
SuperFamilySSF1182901.31E-23210270IPR003657WRKY domain
SMARTSM007743.3E-32211269IPR003657WRKY domain
PfamPF031061.9E-23213268IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.3E-36360435IPR003657WRKY domain
SuperFamilySSF1182907.45E-28367435IPR003657WRKY domain
PROSITE profilePS5081137.333370435IPR003657WRKY domain
SMARTSM007741.8E-35375434IPR003657WRKY domain
PfamPF031062.1E-24377433IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MDRPLSSPSP FSIFDSHFSD SSMNLTNPHS ASDRLGRSGP LAPRFGSSHA AIFSPPATTE  60
ATDTVVATVS SIPNVSRYKL MSPAKLPIAR SISQYAPPGL SPSSLLDSPV QFCNIKVEPS  120
PTTGTLHKPQ PMLGGLGCTA AASTSCANNS ASVGEIANNS EFGTQSHSIF ASGSSFLLNQ  180
RIEGEKAIPS ATVSPSDQND VRSSSVSDNS STDGYNWRKY GQKHVKGCEF PRSYYKCTHP  240
NCEVKKLLER AHDGRITEVI YKGTHSHPKP QSKRRFSNDA AVGMTDEHLE RFSYQSEEMA  300
LNSQAATPDM DGTSELPSGP PSDEELNDDK YDDDGDDPNS KRRKQDMGVT HFISSVKPIR  360
EPRVVVQTVS EVDILVDGYR WRKYGQKVVK GNPNPRSYYK CTNPGCPVRK HVERACHDIK  420
SVITTYEGKH NHDVPSAKAS NQETAAVDPY SGYTSNIGSS MQQNDSVTRV CDHYHQRPPD  480
VRNQYHLEDN EGENFRFATP YLSSNACPQN LGSLLMGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-35213436878Probable WRKY transcription factor 4
2lex_A2e-35213436878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070967.11e-125PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV01e-118WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM9TMC31e-125M9TMC3_JATCU; Uncharacterized protein
STRINGPOPTR_0001s37260.11e-122(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.12e-91WRKY family protein